DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Pdp

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:345 Identity:74/345 - (21%)
Similarity:133/345 - (38%) Gaps:116/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFF-------AVYDGHGGAT 65
            ||.....:|..|   ::||:    |  ..|||.|.         |:|.       .::|||.||.
  Fly    53 PVDGVIRSYETN---QLGSN----W--PCEDSRTE---------ASFLHRNGFICGIFDGHAGAA 99

  Fly    66 VAQYAGKHLHKYV-------------LKRPE--------YNDNIE-------------------- 89
            ..|...|.|.:||             :|:..        :|||::                    
  Fly   100 CGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQL 164

  Fly    90 ---------QALQQGFLDIDYVMLRN-------KTCGDQMAGSTAVVVLVKDNKLYCANAGDSRA 138
                     ..|...||.:|..:.:.       :|....::|:.|.:|.::..:::.|:.||..|
  Fly   165 LETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQMHVASTGDCGA 229

  Fly   139 IACV------NGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNRV--NG----NLALSRALGDYVF 191
            :..|      ....:.|:::|..:|.:|.:||:......|...|  ||    .||..||.||:.:
  Fly   230 VLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRY 294

  Fly   192 KHENKKPEDQI------------------VTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVL 238
            |...:..:.::                  :||.|||:..::..:.:|:|:|.||:||.:..:||:
  Fly   295 KWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVV 359

  Fly   239 EFCRTRIGMGMFPEEICEEL 258
            ..    :|..:..::|.|.:
  Fly   360 SL----VGEHINSKKILEPM 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 70/331 (21%)
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 72/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.