DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and CG15035

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:273 Identity:57/273 - (20%)
Similarity:93/273 - (34%) Gaps:89/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LPDDPGAAFFAVYDGHGG------------ATVAQYAGKHLHKYVLKRPEYNDNIEQALQQGFLD 98
            :...|.|....|.||.||            .|:.:...:..|     .|::..|..:.|    |:
  Fly   138 MSSSPQACIMGVADGVGGWRNYGVDPGKFSMTLMRSCERMSH-----APDFKPNRPEIL----LE 193

  Fly    99 IDYVMLRNKTCGDQMAGS-TAVVVLVK--DNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAE 160
            ..|..|.::.|  .:.|| ||.::.:|  |:.||.||.|||..:...:|::...|.:.:      
  Fly   194 RAYFDLLDQKC--PIVGSCTACILALKRDDSTLYAANIGDSGFLVVRSGKVVCRSQEQQ------ 250

  Fly   161 SKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKPEDQIVTAFPDVETRKIMDDWEFIVLAC 225
                         ::.|....|:.....|.|...:..||......||       |...:.|:||.
  Fly   251 -------------HQFNTPYQLASPPPGYDFDAVSDGPESADTIQFP-------MQLGDVILLAT 295

  Fly   226 DGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGD---NMTVVLVCLL-- 285
            ||::|.:                  ||....|::.       :|.|:...   .|....|.|:  
  Fly   296 DGVYDNV------------------PESFLVEVLT-------EMSGISNPVRLQMAANTVALMAR 335

  Fly   286 -------HGRPYS 291
                   |..|:|
  Fly   336 TLSFSPKHDSPFS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 53/255 (21%)
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 57/273 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.