DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Pp2d1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:458 Identity:89/458 - (19%)
Similarity:149/458 - (32%) Gaps:146/458 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKH--- 73
            |..|.|.|:        ...|:.......|.:....|.....||.::|.|.|...|..|.|.   
  Rat   199 KGIAICSNS--------NSTWKAEPNCKFTVVNDFGDKANVCFFGLFDSHHGYAAADLASKEFQV 255

  Fly    74 --LHKYVLKRPEYN-----------------------------------------DNIEQALQQG 95
              ||:..::.|.|.                                         :::.:|..:.
  Rat   256 LLLHQLSVQDPSYQMTAEQQDLINSFHTVFREEYRAREEAFSSTYKTFRTNKREYEDVHKAFAKA 320

  Fly    96 FLDIDYVML--RNKTCGDQMAGSTAVVVLV----------KD----------------------N 126
            |..:|.::.  ||:....:.:|.:|:..::          ||                      .
  Rat   321 FWRMDRLLRLGRNEVSRVRWSGCSALTCILEGGIKNPQATKDWEKTYQHGVNSSPFQKIPQIISG 385

  Fly   127 KLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVE----FNRVNGNLALSRALG 187
            .|:.||||:.:|:.|.||:...|:.:|...|..|.:|::.....:.    :..::|::..:|.||
  Rat   386 VLHIANAGNVQAVLCRNGKGFCLTKEHTTRNTKERRRVLYSEVGISSDDPYGLLDGHIKTTRGLG 450

  Fly   188 DYVFKHENKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPE 252
                .|.|.:.:..|:.. |...:..|.|..:|::||.:|:|.|:...||     |.:.:.:|  
  Rat   451 ----FHGNLRLKKAIIPV-PQTISVPIDDLCQFLILATNGLWQVLDKKEV-----TALVITLF-- 503

  Fly   253 EICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPY--------SDLIARCRNGSQATNNDQE 309
                    |.....|..|.              ..:|:        .|...|.....|..|.|..
  Rat   504 --------HAYKETCVSGP--------------RNKPWPSKSLLFPPDSNIRVLFQYQPENEDIT 546

  Fly   310 EAGDATK--------DEVAKDEAEAETDTETETQTKP-CQKQSNSGPMDDEVKMASHLNKMAAIE 365
            ...|..|        |.....:..|||.....|...| ..|:|||.|..:. |..|  .|...|:
  Rat   547 STTDVMKRLSDSPFADTNIHQDTSAETFLPKATSYDPYSTKESNSLPTTNS-KQES--EKEICIK 608

  Fly   366 SHY 368
            :.|
  Rat   609 NFY 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 61/345 (18%)
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 56/294 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.