DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1h

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001258008.1 Gene:Ppm1h / 314897 RGDID:1309528 Length:513 Species:Rattus norvegicus


Alignment Length:410 Identity:82/410 - (20%)
Similarity:138/410 - (33%) Gaps:182/410 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SLPDDPG-------------AAFFAVYDGHGGATVAQYAGKHLHKYVLKR--------------- 81
            |||:..|             ..:::::|||.|:..|..|.:.|..::.::               
  Rat   123 SLPNGEGLQLKENSESEGISCHYWSLFDGHAGSGAAVVASRLLQHHITQQLQDIVEILKNSAILP 187

  Fly    82 -----------PEYNDNIEQ-----------------------------------ALQQGFLDID 100
                       |.:...:.:                                   ||:..|.::|
  Rat   188 PTCLGEEPESTPAHGRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMD 252

  Fly   101 YVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNE------- 158
            ..:.|.::..:...|.||::|:....|||.|||||||||...||::..:|.:..|..|       
  Rat   253 LQIERERSAYNISGGCTALIVVCLLGKLYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYL 317

  Fly   159 --------------AESKRIIQG--------------GGW---------VEF---------NRVN 177
                          .|..|.:|.              .||         ::|         .||.
  Rat   318 AFMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVM 382

  Fly   178 GNLALSRALGDYVFK-HENK---KPEDQIVTAFPDVETRKI------MDDWEFIVLACDGIWDVM 232
            ..:.::|.|||:..| |::.   ||   .:::.|:|....:      .||  .::||.||:|||:
  Rat   383 ATIGVTRGLGDHDLKVHDSNIYIKP---FLSSAPEVRVYDLSKYEHGADD--VLILATDGLWDVL 442

  Fly   233 SNAEVLEFCRTRIGMGMFPEEICEELMNHC----------LAPDCQMGGLG-------------- 273
            ||.||              .|...:.:.:|          .|.|..|...|              
  Rat   443 SNEEV--------------AEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRISNDRL 493

  Fly   274 --GDNMTVVLVCLLHGRPYS 291
              ||:::|.::.|:||...|
  Rat   494 GSGDDISVYVIPLIHGNKLS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 78/401 (19%)
Ppm1hNP_001258008.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..133 4/9 (44%)
PP2Cc 142..506 CDD:238083 74/382 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.