DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1l

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001101151.1 Gene:Ppm1l / 310506 RGDID:1305220 Length:360 Species:Rattus norvegicus


Alignment Length:279 Identity:94/279 - (33%)
Similarity:135/279 - (48%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYA--------GKHLHKY 77
            ::.|....:||.|.:|||....:..|.:....:.|.::|||||.|.|:|.        .:||..|
  Rat    90 SHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDY 154

  Fly    78 VLKRPEYNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIAC- 141
            ...:.......:..|:|..|.||..||...|.....||:|.::.|:.|..|..||.||||.:.| 
  Rat   155 EKDKENSVLTYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCD 219

  Fly   142 VNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFN---RVNGNLALSRALGDYVFKHENKKPEDQIV 203
            .:|....||.||||....|.|||.:.||::.||   ||.|.||:||:||||..|:.|      :|
  Rat   220 KDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLN------VV 278

  Fly   204 TAFPDVET---RKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEE--ICEELMNHCL 263
            ...||:.|   .|:..  ||::||.||:||..||.|.:.|.:.|:....|..:  :.:.....| 
  Rat   279 IPDPDILTFDLDKLQP--EFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGC- 340

  Fly   264 APDCQMGGLGGDNMTVVLV 282
                      .||:||::|
  Rat   341 ----------PDNITVMVV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 94/278 (34%)
Ppm1lNP_001101151.1 PP2Cc 93..351 CDD:238083 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.