DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Pptc7

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:278 Identity:56/278 - (20%)
Similarity:95/278 - (34%) Gaps:100/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AAFFAVYDGHG-----GATVAQYAGKHLH---------KYVLKRPEYNDNIEQALQQGFLDIDYV 102
            |....|.||.|     |...:|::|..:.         ::|...|           .|.|...|.
  Rat    74 ADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNP-----------VGILTTSYC 127

  Fly   103 -MLRNKTCGDQMAGSTAVVVLVKD---NKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKR 163
             :|:||.   .:.||:...::|.|   ::|:.||.|||..:....|::.     |:.:.:.    
  Rat   128 ELLQNKV---PLLGSSTACIVVLDRSSHRLHTANLGDSGFLVVRGGEVV-----HRSDEQQ---- 180

  Fly   164 IIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKPEDQ--IVTAFPDVETRKIMDD--WEFIVLA 224
                      :..|....||.|           .||.:  :::..||.......|.  .:.|:.|
  Rat   181 ----------HYFNTPFQLSIA-----------PPEAEGVVLSDSPDAADSTSFDVQLGDIILTA 224

  Fly   225 CDGIWDVM--------------SNAEVLEFCRTRIG------------MGMFPEEICEELMNHCL 263
            .||::|.|              ||.|.::.....|.            |..|.:..|:..:|   
  Rat   225 TDGLFDNMPDYMILQELKKLKNSNYESIQRTARSIAEQAHELAYDPNYMSPFAQFACDNGLN--- 286

  Fly   264 APDCQMGGLGGDNMTVVL 281
                 :.|...|::||:|
  Rat   287 -----VRGGKPDDITVLL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 56/278 (20%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 55/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.