DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1j

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_008759602.1 Gene:Ppm1j / 295341 RGDID:1359104 Length:522 Species:Rattus norvegicus


Alignment Length:345 Identity:72/345 - (20%)
Similarity:121/345 - (35%) Gaps:127/345 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEPVTAKESAY-----CQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFF--AVYDGHGG 63
            :|.:.|.:|.:     |....|......:.|  ::.|.||        :.|.:|:  .::|||.|
  Rat   125 AEVINAGKSRHNEDQACCEVVYVESRRSITG--VSREPSH--------NQGFSFYYWGLFDGHAG 179

  Fly    64 ATVAQYAGKHLHKYVLKRPEYNDNIE--------------------------------------- 89
            ...|:.|.:.||:::  |.:..|.:|                                       
  Rat   180 GGAAEMASRLLHRHI--REQLKDLVEILQDPLPPPLCLPSTPGTPGVSSPSQLVSPQSWSPQKEV 242

  Fly    90 -------QALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLE 147
                   .|::..|..:|..|.|.:.......|..|:||:....|:|.|||||||||...||::.
  Rat   243 THDSLVVGAIENAFQLMDEQMARERRGHLVEGGCCALVVVYLLGKMYVANAGDSRAIIVRNGEII 307

  Fly   148 VLSLDHKPNNEAESKRII-----------------------------------QGGGW----VEF 173
            .:|.:..|..|.:..:::                                   ...||    :|.
  Rat   308 PMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVQPKELGQRMLYRDQNMTGWAYKKIEL 372

  Fly   174 N--------------RVNGNLALSRALGDYVFK-HENKKPEDQIVTAFPDVETRKIM------DD 217
            .              ||...:.::|.|||:..| ..:..|....::.||:|....:.      ||
  Rat   373 EDLRFPLVCGEGKKARVMATIGVTRGLGDHNLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDD 437

  Fly   218 WEFIVLACDGIWDVMSNAEV 237
              .:||..||:|||.:::||
  Rat   438 --VLVLGTDGLWDVTNDSEV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 68/324 (21%)
Ppm1jXP_008759602.1 PP2Cc 123..514 CDD:238083 72/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.