DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1n

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038959919.1 Gene:Ppm1n / 292690 RGDID:1562091 Length:409 Species:Rattus norvegicus


Alignment Length:281 Identity:116/281 - (41%)
Similarity:166/281 - (59%) Gaps:14/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RVGSSCMQGWRINMEDSHTHILSLPDDP-GAAFFAVYDGHGGATVAQYAGKHLHKYVL----KRP 82
            |.|:|.:||||..|||:|...|:||..| |.|||||.||||||..|::..:||..:||    ..|
  Rat    59 RFGASAVQGWRARMEDAHCAQLALPGLPSGWAFFAVLDGHGGARAARFGARHLPGHVLGELGPAP 123

  Fly    83 EYNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLE 147
            ...|.:.|||:..||..|..:.:.....|. .|||||.:||....||.|:.|||||:...:|.:.
  Rat   124 REPDGVRQALRSAFLHADSQLSKLWPRCDP-GGSTAVALLVSPRFLYLAHCGDSRALLSRSGSVA 187

  Fly   148 VLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKH-ENKKPEDQIVTAFPDVET 211
            ..:.||:|:...|.:||...||.|...||.|:||:||||||:.:|. ..:.||.|:|:|.|:|..
  Rat   188 FCTEDHRPHRPRERERIHDAGGTVRRRRVEGSLAVSRALGDFAYKQAPGRPPELQLVSAEPEVAA 252

  Fly   212 RKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGDN 276
            ....|:.||::||.||:||.:|.|::.....:|:.:|:.||.:|.:|::.||   |: |.|  ||
  Rat   253 LARQDEDEFVLLASDGVWDALSGADLAGLVTSRLRLGLDPELLCAQLLDTCL---CK-GSL--DN 311

  Fly   277 MTVVLVCLLHG-RPYSDLIAR 296
            ||.::||.... ||..:.|::
  Rat   312 MTCMVVCFPGAPRPCEEAISK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 112/266 (42%)
Ppm1nXP_038959919.1 PP2Cc 59..319 CDD:238083 112/266 (42%)
PP2C_C 313..>345 CDD:421906 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.