DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Pdp2

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_659559.2 Gene:Pdp2 / 246311 RGDID:628812 Length:530 Species:Rattus norvegicus


Alignment Length:291 Identity:72/291 - (24%)
Similarity:102/291 - (35%) Gaps:110/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FAVYDGHGGATVAQYAGKHLHKYV-----------------------------LKRPE---YND- 86
            |.::|||||...||...:.|..|:                             ||.|.   |.| 
  Rat   138 FGIFDGHGGHACAQAVSERLFYYMAVSLMSHKTLEQMEEAMENMKPLLPILQWLKHPGDSIYKDI 202

  Fly    87 ------------------------NIEQALQQGF--LDIDYVM----------LRNKTCGDQMAG 115
                                    :.|:||...|  ||.|..:          .:|.:.....:|
  Rat   203 TSVHLDHLRVYWQELLDLHMETGLSTEEALMYSFQRLDSDISLEIQAPLEDEVTKNLSLQVAFSG 267

  Fly   116 STAVVVLVKDNKLYCANAGDSRAIACV---NGQLEVLSL--DHKPNNEAESKRI------IQGGG 169
            :||.:..|....|:.|||||.|||..|   ||....|.|  ||...||||..|:      .:...
  Rat   268 ATACMAHVDGVHLHIANAGDCRAILGVQGDNGAWSCLPLTCDHNAWNEAELSRLKREHPESEDRT 332

  Fly   170 WVEFNRVNGNLALSRALGDYVFK---------------------------HENKKPEDQIVTAFP 207
            .:..:|:.|.|...||.||...|                           |.:..|   .:||.|
  Rat   333 LIIDDRLLGVLLPCRAFGDVQLKWSKELQRNVLERGFDTEALNIYQFTPPHYHTPP---YLTAKP 394

  Fly   208 DVETRKIMDDWEFIVLACDGIWDVMSNAEVL 238
            :|...::....:|:|||.||:||::.|.:|:
  Rat   395 EVTYHRLRPQDKFLVLASDGLWDMLDNEDVV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 72/291 (25%)
Pdp2NP_659559.2 PP2Cc 96..516 CDD:214625 72/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.