DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1k

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_780732.1 Gene:Ppm1k / 243382 MGIID:2442111 Length:372 Species:Mus musculus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:130/275 - (47%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYNDNI 88
            ||.:.:.|.|...|| ......|.::  ..:|||||||||...|.:...|:.|.|:.......::
Mouse    95 VGCASLIGKRKENED-RFGFAQLTEE--VLYFAVYDGHGGPAAADFCHTHMEKCVMDLLPREKDL 156

  Fly    89 EQALQQGFLDID-----YVMLRNKTCGDQMAGSTAVVVLVKDN-KLYCANAGDSRAIACVNGQLE 147
            |..|...||:||     |..| :.......:|:||.|.|::|. :|..|:.|||||:.|..|:..
Mouse   157 ETVLTLAFLEIDKAFASYAHL-SADASLLTSGTTATVALLRDGVELVVASVGDSRALLCRKGKPM 220

  Fly   148 VLSLDHKPNNEAESKRIIQGGGWVEFN-----RVNGNLALSRALGDYVFKHENKKPEDQIVTAFP 207
            .|:.||.|..:.|.:||.:.||:|.:|     .|||.||::|::||...|...       |.|.|
Mouse   221 KLTTDHTPERKDEKERIKKFGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKASG-------VIAEP 278

  Fly   208 DVETRKI--MDDWEFIVLACDGIWDVMSNAEVLEF---CRTRIGMGMFPEEICEELMNHCLAPDC 267
            :....|:  .|| .|:||..|||..::::.|:.:|   |..       |:|....:....:    
Mouse   279 ETTRIKLYHADD-SFLVLTTDGINFMVNSQEICDFVNQCHD-------PKEAAHSVTEQAI---- 331

  Fly   268 QMGGLGGDNMTVVLV 282
            |.|  ..||.|.|:|
Mouse   332 QYG--TEDNSTAVVV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 87/275 (32%)
Ppm1kNP_780732.1 PP2Cc 95..346 CDD:238083 87/275 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.