DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and tap-1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_510428.1 Gene:tap-1 / 181556 WormBaseID:WBGene00006524 Length:386 Species:Caenorhabditis elegans


Alignment Length:419 Identity:85/419 - (20%)
Similarity:146/419 - (34%) Gaps:144/419 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLH 75
            :|:....||..:...|.|:....|.:                  :.::.|..|       |....
 Worm    27 SKQKNPVQNNDFLSCSMCIHNGPIKL------------------YGIFSGFNG-------GDSTA 66

  Fly    76 KYVLKRPEYN------------------------DNI-EQALQQGFLDIDYVMLR----NKTCGD 111
            |:|:.|..|.                        :|: |:.|.....|::..:|:    ::|..:
 Worm    67 KFVMNRLVYEIFGENPITPTLLPYQVVEEFKRKFENVAERYLLMNTDDLNNRLLKLEEQSETGNN 131

  Fly   112 QMA--------GSTAVVVLVKDNKLYCANAGDSRAIACVNGQLEVLSLD---HKPNNEAESKRII 165
            .::        |:||:||::.:..||..|.|:|.||| :|.: .|:.|:   |..:|..|..| |
 Worm   132 AVSEINQKIRQGTTAIVVMIINQDLYVLNCGNSLAIA-MNSE-NVVQLNSNLHNNDNPLEIVR-I 193

  Fly   166 QGGGWVEFNRVNGNLAL--SRALGDY----------VFKHENKKPEDQIVTAFPDVETRKIMDDW 218
            :|.|      :|....|  :||:||.          .||:....|    |.:.|||:..||...|
 Worm   194 KGLG------INPETVLNPTRAIGDLQRTHLFEETEAFKNAKGPP----VISTPDVQYTKIDPSW 248

  Fly   219 EFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELM-NHCLAPDCQMGGLGGDNMTVVLV 282
            ..:||..||:...:...||..          .|.|:...|: :|.:....|           .||
 Worm   249 RHLVLISDGVVQNLKEVEVEN----------IPTEVSVRLIEDHTVTSTAQ-----------ALV 292

  Fly   283 CLLHGRPYSDLIARCRNGSQATNNDQEEAGDATKDEVAK-----------------DEAEAETDT 330
                     |..||....:...::|:.......::|:..                 |.|.:..::
 Worm   293 ---------DSFARKHRDAYTMSDDKNFCISNHREEMTVIYVKLEEDYQAALYEQFDSAISTMES 348

  Fly   331 ETETQTKPCQ------KQSNSGPMDDEVK 353
            ...|..:||.      ...|||...:::|
 Worm   349 TNATLYEPCSTPYVDATNFNSGKNYEKMK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 68/314 (22%)
tap-1NP_510428.1 PP2Cc 21..327 CDD:238083 76/367 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.