DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PPM1L

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_640338.2 Gene:PPM1L / 151742 HGNCID:16381 Length:360 Species:Homo sapiens


Alignment Length:278 Identity:94/278 - (33%)
Similarity:135/278 - (48%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYA--------GKHLHKYV 78
            :.|....:||.|.:|||....:..|.:....:.|.::|||||.|.|:|.        .:||..|.
Human    91 HNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYE 155

  Fly    79 LKRPEYNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIAC-V 142
            ..:.....:.:..|:|..|.||..||...|.....||:|.::.|:.|..|..||.||||.:.| .
Human   156 KDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDK 220

  Fly   143 NGQLEVLSLDHKPNNEAESKRIIQGGGWVEFN---RVNGNLALSRALGDYVFKHENKKPEDQIVT 204
            :|....||.||||....|.|||.:.||::.||   ||.|.||:||:||||..|:.|      :|.
Human   221 DGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLN------VVI 279

  Fly   205 AFPDVET---RKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEE--ICEELMNHCLA 264
            ..||:.|   .|:..  ||::||.||:||..||.|.:.|.:.|:....|..:  :.:.....|  
Human   280 PDPDILTFDLDKLQP--EFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGC-- 340

  Fly   265 PDCQMGGLGGDNMTVVLV 282
                     .||:||::|
Human   341 ---------PDNITVMVV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 94/278 (34%)
PPM1LNP_640338.2 PP2Cc 93..351 CDD:238083 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.