DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PP2D1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001239586.1 Gene:PP2D1 / 151649 HGNCID:28406 Length:630 Species:Homo sapiens


Alignment Length:407 Identity:85/407 - (20%)
Similarity:151/407 - (37%) Gaps:107/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKH-----LHK--------------- 76
            |:.:|.|..|.:.:..:.|...||.::|||.||:.|:.....     ||:               
Human   181 WKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASAAELTSMELPVLLLHQLSKFDPSYQMTTDEQ 245

  Fly    77 ------YVLKRPEY-------------------NDNIEQALQQGFLDIDYV--MLRNKTCGDQMA 114
                  |.:.|.||                   .::..:|..:.|..:|.:  :.|.:....|.:
Human   246 QIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWS 310

  Fly   115 GSTAVVVLVKDNK----------------------------------LYCANAGDSRAIACVNGQ 145
            |.:||..:::...                                  |:.||.|:.:|:.|.||:
Human   311 GCSAVTCILEGKPKSPYAHKNWKRKNTHDGLAESSPSQEMPKIISGILHVANTGNVQAVLCRNGK 375

  Fly   146 LEVLSLDHKPNNEAESKRIIQGGGWVEFNR----VNGNLALSRALGDYVFKHENKKPEDQIVTAF 206
            ...|:.:|...|..|.:||:|.|..:..|.    |.|.:..:|.||    .|.|.|.:..|:.| 
Human   376 GFCLTKEHTTRNTNERRRILQNGAVISSNEPYGLVEGQVKTTRGLG----FHGNLKLKKSIIPA- 435

  Fly   207 PDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGG 271
            |...:..|.|..:|:::|.:|:|:|:...||.....|.  ..|:.|..|..:.|...:....:..
Human   436 PQTISVPIDDLCQFLIVATNGLWEVLDKEEVTALAMTT--FHMYKETYCPIIPNKSPSKGPLLFS 498

  Fly   272 LGGDNMTVVLVCLLHGRPYSDL--IARCRNGSQ---ATNNDQEEAGDATKDEVAKDEAE-AETDT 330
            ....|:|         :..|::  :.:.::.|:   :|.|.:|...|:...:......| .||..
Human   499 TSEPNLT---------KSQSNIHVLFQYKSVSEVRVSTTNSKENLSDSNYSKYCIYNPENVETFP 554

  Fly   331 ETETQTKPCQKQSNSGP 347
            ...|..|||.::....|
Human   555 AETTHRKPCSEKVTDRP 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 71/336 (21%)
PP2D1NP_001239586.1 PP2Cc 181..466 CDD:238083 62/289 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..578 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.