DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp4B and SLF1

DIOPT Version :9

Sequence 1:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster
Sequence 2:NP_010803.3 Gene:SLF1 / 852127 SGDID:S000002923 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:38/161 - (23%)
Similarity:70/161 - (43%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PLDKLKQMLATQLEYYFSRENLANDTYLLSQMD--SDQYVPIYTVARF----NLVRKLTNDINLI 322
            |:.|..:.:..|:|:|||.|||..|.:|.|:..  :|.::|:..:.:|    ||  .|..|.|||
Yeast   267 PIFKSIESIKNQIEFYFSEENLKTDEFLRSKFKKANDGFIPMSLIGKFYRMVNL--SLGGDPNLI 329

  Fly   323 TEVLRESPNVQVDDKGLRVRPNRKRCIIILREISNNTPLDDVKALFSNESCPRPISCEFAANNSW 387
            ...:||                     ::..:.:|:..:    ||.|.|...:.::.:|....::
Yeast   330 LASMRE---------------------VLQHKETNHLEI----ALGSIEGAQKNMADDFNPLENY 369

  Fly   388 YITFES----------DEDAQKAYKYLREEV 408
            :|..|:          ||:..:..||..|::
Yeast   370 FIRRENWAEYAMESNFDENDDETEKYNIEKL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 23/79 (29%)
RRM_LARP4_5_like 348..423 CDD:240876 13/71 (18%)
SLF1NP_010803.3 LHP1 3..443 CDD:227520 38/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9176
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.