DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp4B and LARP6

DIOPT Version :9

Sequence 1:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster
Sequence 2:NP_060827.2 Gene:LARP6 / 55323 HGNCID:24012 Length:491 Species:Homo sapiens


Alignment Length:342 Identity:75/342 - (21%)
Similarity:127/342 - (37%) Gaps:101/342 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PANGSADPQQGSH-----NAAGGE--------EPNIPLDKLKQMLATQLEYYFSRENLANDTYLL 292
            |..|||..::.|.     .|:|||        |...|.::|.:.|..|:|:|||.|||..|.:||
Human    52 PGWGSASEEEPSRGHSGTTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLL 116

  Fly   293 SQMDSDQ--YVPIYTVARFNLVRKLTNDINLITEVLRESPNVQVDDKGLRVR--------PNR-- 345
            ..:..::  ||.:..:..|..|:.||.|.......|:.|..:::::...:||        ||.  
Human   117 KHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENL 181

  Fly   346 --KRCII----------------------------ILREISNNTPLDDVKALFSNESCP---RPI 377
              |..::                            :|:.......:..|:.|......|   |.|
Human   182 PSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRI 246

  Fly   378 SCEFA---ANNSWYITFESDEDAQKAYKYLREEVKEFQGKPIMARI---------KP-------- 422
            |..::   ......:.||..|.|.||::::   :.|.|||..|..:         ||        
Human   247 SSRYSQVGTQECAIVEFEEVEAAIKAHEFM---ITESQGKENMKAVLIGMKPPKKKPAKDKNHDE 308

  Fly   423 ---------KSFINRIQAV----PKNGYRLTSPPTANVFDP-AGAGGATVS--YAAAQQPRYLYT 471
                     ||...|::.:    .::....:|.|.:|...| ||...|..:  ..:..|..:|..
Human   309 EPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSP 373

  Fly   472 NGAAIAAPASVQYSNPV 488
            |    |:|.:..:|:|:
Human   374 N----ASPCTSPWSSPL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 23/83 (28%)
RRM_LARP4_5_like 348..423 CDD:240876 20/134 (15%)
LARP6NP_060827.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87 10/34 (29%)
LARP_6 93..169 CDD:153402 22/75 (29%)
RRM_LARP6 184..292 CDD:409731 19/110 (17%)
Nuclear export signal 186..193 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..403 19/98 (19%)
Nuclear localization signal 296..302 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..491
SUZ-C 452..484 CDD:403952
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.