DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp4B and Larp6

DIOPT Version :9

Sequence 1:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster
Sequence 2:NP_001101624.1 Gene:Larp6 / 315731 RGDID:1308414 Length:492 Species:Rattus norvegicus


Alignment Length:344 Identity:81/344 - (23%)
Similarity:128/344 - (37%) Gaps:105/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PANGSA---DPQQGSHNA--AGGE------EP--NIPLDKLKQMLATQLEYYFSRENLANDTYLL 292
            |..|||   :|.:|..:|  :|||      ||  ..|.::|.:.|..|:|:|||.|||..|.:||
  Rat    52 PGWGSASEEEPSRGHSSATTSGGENDREDLEPEWKPPDEELIRKLVDQIEFYFSDENLEKDAFLL 116

  Fly   293 SQMDSDQ--YVPIYTVARFNLVRKLTNDINLITEVLRESPNVQVDDKGLRVR--------PNR-- 345
            ..:..::  ||.:..:..|..|:.||.|.......|:.|..:::::...:||        ||.  
  Rat   117 KHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVTLELNEDHRKVRRTTPVPLFPNENL 181

  Fly   346 --KRCIIILREISNN-----TP-----------------------LDDVKALFSNESCP---RPI 377
              |..::....:|..     ||                       :..|:.|......|   |.|
  Rat   182 PSKMLLVYDLHLSPKLWSLATPPKNGRVQEKVMEYLLKLFGTFGVISSVRILKPGRELPPDIRRI 246

  Fly   378 SCEFA---ANNSWYITFESDEDAQKAYKYLREEVKEFQGKPIMARI---------KPKSFINRIQ 430
            |..::   ......:.||..:.|.||::::   ..|.|||..|..:         ||....|. :
  Rat   247 SSRYSQVGTQECAIVEFEEVDAAIKAHEFM---ATESQGKENMKAVLIGMRPPKKKPLKDKNH-E 307

  Fly   431 AVPKNGYRL----------------------TSPPTANVFDPAGAGGATVS----YAAAQQPRYL 469
            ..|..|.||                      :|.|.:|...|. ||...|:    ..:..|..:|
  Rat   308 DEPAAGTRLSRSLNKRVEELQYMGDESSANSSSDPESNPTSPM-AGRRHVASNKLSPSGHQNIFL 371

  Fly   470 YTNGAAIAAPASVQYSNPV 488
            ..|    |:|.|..:|:|:
  Rat   372 SPN----ASPCSSPWSSPL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 23/83 (28%)
RRM_LARP4_5_like 348..423 CDD:240876 20/117 (17%)
Larp6NP_001101624.1 LARP_6 93..169 CDD:153402 22/75 (29%)
RRM_LARP6 184..292 CDD:240735 20/110 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.