DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp4B and Larp1b

DIOPT Version :9

Sequence 1:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster
Sequence 2:XP_038958171.1 Gene:Larp1b / 310348 RGDID:1307509 Length:537 Species:Rattus norvegicus


Alignment Length:115 Identity:40/115 - (34%)
Similarity:63/115 - (54%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PLDK--LKQMLATQLEYYFSRENLANDTYLLSQMDSDQYVPIYTVARFNLVRKLTNDINLITEVL 326
            |:::  ||:.:..|:|||||.|||..|.:|..:||...::||..:|.|:.|:.||.::|||.|.|
  Rat   411 PVEETLLKEYIKRQIEYYFSIENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNLNLILEAL 475

  Fly   327 RESPNVQVDDKGLR--VRPNRKRCIIILREISNNTPLDDVKALFSNESCP 374
            ::|..|::.|:.:|  :.|.:..   |......|.|..|...|.   .||
  Rat   476 KDSTEVEIVDEKMRKKIEPEKWP---IPGPPPRNVPQTDFSQLI---DCP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 30/75 (40%)
RRM_LARP4_5_like 348..423 CDD:240876 7/27 (26%)
Larp1bXP_038958171.1 LARP_2 418..490 CDD:153407 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.