DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp4B and SPAC1527.03

DIOPT Version :9

Sequence 1:NP_647793.1 Gene:Larp4B / 38399 FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster
Sequence 2:NP_594554.1 Gene:SPAC1527.03 / 2541645 PomBaseID:SPAC1527.03 Length:475 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:39/136 - (28%)
Similarity:58/136 - (42%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 ADPQQGSH---------------------NAAGGEEPNIP-----------LDKLKQMLATQLEY 278
            :|.||..|                     |...|..||.|           |..::..|.:||||
pombe   271 SDSQQSFHHKGRNTRKGQRHNNGFYRNIANNIQGPFPNYPVVVNGNGVNPYLCDVQAFLTSQLEY 335

  Fly   279 YFSRENLANDTYLLSQMDSDQYVPIYTVARFNLVRKLTNDINLITEVLRESP--NVQVD-DKGLR 340
            |||.|||..|.:|...||.:.|||:..:|.||.::..:.|:||:....:.|.  :|.:| ...:.
pombe   336 YFSIENLCKDMFLRKHMDDEGYVPLAFLASFNRIKSFSTDLNLLHAACKASDIIDVAIDLQSPMS 400

  Fly   341 VRPNRK 346
            ::..||
pombe   401 IKVRRK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 27/76 (36%)
RRM_LARP4_5_like 348..423 CDD:240876
SPAC1527.03NP_594554.1 LHP1 4..473 CDD:227520 39/136 (29%)
LA 323..406 CDD:128955 27/82 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.