DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and AT4G29410

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001078470.1 Gene:AT4G29410 / 829062 AraportID:AT4G29410 Length:143 Species:Arabidopsis thaliana


Alignment Length:140 Identity:49/140 - (35%)
Similarity:75/140 - (53%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAT-SSHLNWLIIRNNNAFLLK---KRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADK 61
            ||| ...|.|.|::.||.||:|   :.:.|..||.|.|||.:::||::||:.:|||:.:..|...
plant     1 MATVPGQLIWEIVKRNNCFLVKQFGRGNAKVQFSKESNNLVNINSYKHSGLANKKTVTIQAAGKD 65

  Fly    62 KGFTAVLKKGKYAQRPA----KNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAV- 121
            :|......|.|...:|.    |:.::.:|.    |..|.:.|.::.:.||.||.:|||.|.||: 
plant    66 QGVVLGTTKTKRQNKPKLSVNKSILKKEFS----RMSKVVANQVVDNYYRPDLKKAALARLSAIS 126

  Fly   122 --LRSQKPAP 129
              ||..|..|
plant   127 KGLRVAKSGP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 42/125 (34%)
AT4G29410NP_001078470.1 Ribosomal_L28e 8..125 CDD:396372 41/120 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3315
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2440
OMA 1 1.010 - - QHG55213
OrthoDB 1 1.010 - - D1593474at2759
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - otm3327
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.