DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and AT2G19730

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001031374.1 Gene:AT2G19730 / 816492 AraportID:AT2G19730 Length:143 Species:Arabidopsis thaliana


Alignment Length:143 Identity:53/143 - (37%)
Similarity:80/143 - (55%) Gaps:14/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAT-SSHLNWLIIRNNNAFLLK---KRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADK 61
            ||| ...|.|.|::|||.||:|   :.:.|..||.|.|||.:|.||::||:.:|||: .:.||||
plant     1 MATVPGQLIWEIVKNNNCFLVKQFGRGNSKVQFSKETNNLTNVHSYKHSGLANKKTV-TIQAADK 64

  Fly    62 -KGFTAVLKKGKYAQRPA----KNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAV 121
             :.......|.|...:|.    |:.::.:|   ||.| |.:.|.::.:.||.||.:|||.|.||:
plant    65 DQAVVLATTKTKKQNKPKLSVNKSILKKEF---PRMS-KAVANQVVDNYYRPDLKKAALARLSAI 125

  Fly   122 LRSQKPAPVKGKK 134
            .:..:.|....|:
plant   126 SKGLRVAKSGAKQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 48/123 (39%)
AT2G19730NP_001031374.1 Ribosomal_L28e 8..125 CDD:396372 47/121 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3315
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2440
OMA 1 1.010 - - QHG55213
OrthoDB 1 1.010 - - D1593474at2759
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - otm3327
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - O PTHR10544
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.