DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and Rpl28l3

DIOPT Version :10

Sequence 1:NP_647791.2 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_063129916.1 Gene:Rpl28l3 / 690096 RGDID:1585117 Length:112 Species:Rattus norvegicus


Alignment Length:112 Identity:45/112 - (40%)
Similarity:73/112 - (65%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68
            |:||.|:::||.::||:|:.  |:.:|||||||.:.:|.||:|::|:||:||.||||.||...|:
  Rat     2 SAHLQWMVVRNCSSFLIKRN--KQTYSTEPNNLKARNSLRYNGLIHRKTVGVEPAADGKGVVVVM 64

  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRK---DLTQ 112
            |:....::||.:.||.........:|..::.::..:|||.   ||.|
  Rat    65 KRRSGQRKPATSYVRTTINKNAPATLSSIRQMIRKNKYRPGAGDLAQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_647791.2 Ribosomal_L28e 7..124 CDD:460323 43/109 (39%)
Rpl28l3XP_063129916.1 None

Return to query results.
Submit another query.