DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and rpl28

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_017950884.2 Gene:rpl28 / 549468 XenbaseID:XB-GENE-1016753 Length:144 Species:Xenopus tropicalis


Alignment Length:136 Identity:65/136 - (47%)
Similarity:95/136 - (69%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68
            |:||.|::|||.::||:|:.  .:.||||||||.:.:|:||:|::||||:||.||||.||...||
 Frog     9 SAHLQWMVIRNCSSFLVKRN--HRIFSTEPNNLKARNSFRYNGLIHKKTVGVEPAADGKGVIVVL 71

  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGK 133
            ||....::||.:..::......|.:|..:::::..:.|||||..||||||||:|:||||..||.|
 Frog    72 KKRAGQRKPATSYEKITINKNSRSTLSSVRHIIRKNNYRKDLRMAALRRASAILKSQKPVVVKKK 136

  Fly   134 KAEFAK 139
            :...||
 Frog   137 RTRAAK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 53/115 (46%)
rpl28XP_017950884.2 Ribosomal_L28e 12..126 CDD:396372 53/115 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6152
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H768
Inparanoid 1 1.050 131 1.000 Inparanoid score I4508
OMA 1 1.010 - - QHG55213
OrthoDB 1 1.010 - - D1593474at2759
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - oto102543
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1124
SonicParanoid 1 1.000 - - X3821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.