DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and rpl28

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_957355.1 Gene:rpl28 / 394036 ZFINID:ZDB-GENE-040930-10 Length:138 Species:Danio rerio


Alignment Length:136 Identity:59/136 - (43%)
Similarity:95/136 - (69%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68
            |.||.|::|||:::||:|:.  |:.:|||||||.:.:::|::|::|:||:|:.||||.||...||
Zfish     3 SPHLQWMVIRNSSSFLIKRN--KQTYSTEPNNLKARNAFRFNGLIHRKTIGIEPAADGKGVVVVL 65

  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGK 133
            ||....::||.:..::......|.:|..::|::..:|||:||..|||||.||:|.||||..|:.|
Zfish    66 KKRSGQRKPATSYGKITINKNSRATLASVRNIIRKNKYRRDLRMAALRRVSAILSSQKPVVVRKK 130

  Fly   134 KAEFAK 139
            ::...|
Zfish   131 RSRAPK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 49/115 (43%)
rpl28NP_957355.1 Ribosomal_L28e 6..118 CDD:280030 48/113 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579993
Domainoid 1 1.000 111 1.000 Domainoid score I6207
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H768
Inparanoid 1 1.050 127 1.000 Inparanoid score I4663
OMA 1 1.010 - - QHG55213
OrthoDB 1 1.010 - - D1593474at2759
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - oto41197
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3821
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.