DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and rpl44

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_593124.1 Gene:rpl44 / 2542782 PomBaseID:SPAC1687.06c Length:134 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:49/136 - (36%)
Similarity:76/136 - (55%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATSSHLNWLIIRNNNAFLLKKRDVKKP------FSTEPNNLASVSSYRYSGIVHKKTLGVVPAA 59
            |:.|:.|.|.:||:||.||     ||:|      |:.||.|::..::.|:||:.:.|.:| |.|.
pombe     1 MSVSNDLIWQVIRDNNRFL-----VKRPEFGGIQFNREPVNVSGKNAQRFSGLCNDKAVG-VQAN 59

  Fly    60 DKKGFTAVLKKG-KYAQRPAKNTVRVDF--KAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAV 121
            ..:|...:.|.. |.||:||| ..|.|.  .|..|::.|.:...:..:.||.||.:.::.||||:
pombe    60 SPRGVVLITKTNPKNAQKPAK-LFRKDVIANASSRKTYKSIAGRIGRTGYRDDLVKVSVARASAI 123

  Fly   122 LRSQKP 127
            |.||:|
pombe   124 LSSQRP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 43/124 (35%)
rpl44NP_593124.1 Ribosomal_L28e 7..123 CDD:280030 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3016
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H768
Inparanoid 1 1.050 71 1.000 Inparanoid score I1927
OMA 1 1.010 - - QHG55213
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - oto100608
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1124
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.