DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and Rpl28

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_033107.1 Gene:Rpl28 / 19943 MGIID:101839 Length:137 Species:Mus musculus


Alignment Length:136 Identity:62/136 - (45%)
Similarity:95/136 - (69%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68
            |:||.|:::||.::||:|:.  |:.:|||||||.:.:|:||:|::|:||:||.||||.||...|:
Mouse     2 SAHLQWMVVRNCSSFLIKRN--KQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVM 64

  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGK 133
            |:....::||.:.||.......|.:|..:::::..:|||.||..||:|||||:||||||..||.|
Mouse    65 KRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVVVKRK 129

  Fly   134 KAEFAK 139
            :....|
Mouse   130 RTRPTK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 50/115 (43%)
Rpl28NP_033107.1 Ribosomal_L28e 5..119 CDD:396372 50/115 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836468
Domainoid 1 1.000 114 1.000 Domainoid score I6100
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H768
Inparanoid 1 1.050 130 1.000 Inparanoid score I4625
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55213
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - oto92240
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1124
SonicParanoid 1 1.000 - - X3821
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.