DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL28 and LOC100362069

DIOPT Version :9

Sequence 1:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_038956775.1 Gene:LOC100362069 / 100362069 RGDID:2318912 Length:137 Species:Rattus norvegicus


Alignment Length:136 Identity:62/136 - (45%)
Similarity:96/136 - (70%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68
            |:||.|:::||.::||:|:.  |:.:|||||||.:.:|:||:|::|:||:||.||||.||...|:
  Rat     2 SAHLQWMVVRNCSSFLIKRN--KQTYSTEPNNLKAGNSFRYNGLIHRKTVGVEPAADGKGVVVVM 64

  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGK 133
            |:....::||.:.||.......|.:|..:::::..:|||.||:.||:|||||:||||||..||.|
  Rat    65 KRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLSMAAIRRASAILRSQKPVVVKRK 129

  Fly   134 KAEFAK 139
            :....|
  Rat   130 RTRPTK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 50/115 (43%)
LOC100362069XP_038956775.1 Ribosomal_L28e 5..119 CDD:396372 50/115 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10544
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.