DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hob and ptn

DIOPT Version :10

Sequence 1:NP_647789.2 Gene:hob / 38395 FlyBaseID:FBgn0035420 Length:2300 Species:Drosophila melanogaster
Sequence 2:XP_004912529.1 Gene:ptn / 100101785 XenbaseID:XB-GENE-481634 Length:161 Species:Xenopus tropicalis


Alignment Length:62 Identity:18/62 - (29%)
Similarity:29/62 - (46%) Gaps:18/62 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   948 SLKRKALFDKKIGELCSERLLL--PSGTIEGLYANLVKKNSEIYIQRSKKIRESGPVRTRLL 1007
            |||| ||.:.:    |.:.:.|  |.|           |.::..:|.|||.::.|..:.:||
 Frog   115 SLKR-ALHNAE----CQKTVTLSKPCG-----------KVTKPKLQESKKKKKEGKNKEKLL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hobNP_647789.2 Fmp27 26..>414 CDD:431223
Fmp27_GFWDK 1071..1203 CDD:402113
Apt1 1774..2239 CDD:463055
ptnXP_004912529.1 PTN_MK_N 41..125 CDD:470593 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.