DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG17239

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:237 Identity:78/237 - (32%)
Similarity:118/237 - (49%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGD 90
            :|.||....:....:..::.|.|:|.||..|.|.:.|:||||||..|..:...:.|.:.....|.
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGG 87

  Fly    91 DMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSN--LTVL 153
            .:    ||.: .|.|...|  .:...:|:||:||.....:....|::.:  .|.||.|.  .||.
  Fly    88 QV----VRVS-SVLLHEEY--DQSWSNDIAVMRLQSKLRLGSAVSVIPL--ADTPPASGSPATVS 143

  Fly   154 GWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAI 218
            |||||..: .|:...:..|:|.::...:|.:|.|   :|:|.:|.||... .:|||.||||||.:
  Fly   144 GWGAIGFK-KNYPMSILSASVDIVDQDQCRRSYG---RKITKDMICAAAP-GKDACSGDSGGPLV 203

  Fly   219 YAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFIER 259
            ...:.|||||:|..|. ..|||||..::  .:..|:...|||
  Fly   204 SGNKLVGIVSFGKECAHPEYPGVYANVA--ELKPWILGAIER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 74/222 (33%)
Tryp_SPc 27..246 CDD:238113 74/221 (33%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 74/229 (32%)
Tryp_SPc 24..237 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.