DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG34458

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:126/260 - (48%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAH 67
            |||:.:..:|    |.:....:.:|.||:..........|:|:..|:..|||.:||...::||||
  Fly    12 ILLLAVTFVH----SDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAH 72

  Fly    68 CLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAG 132
            |..|:........|.......|:.   :....|.:: :.|.|..| ..|.|:::|:||.|..:.|
  Fly    73 CTMGQNPGQMKAIVGTNDLSAGNG---QTFNIAQFI-IHPRYNPQ-SQDFDMSLIKLSSPVPMGG 132

  Fly   133 NASLVKIDYNDLPPHSNLT------VLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQ 191
            ....:::..:|    ||..      :.|:||||:.....|: |:.|.|:|.|...|......|  
  Fly   133 AVQTIQLADSD----SNYAADTMAMISGFGAINQNLQLPNR-LKFAQVQLWSRDYCNSQNIPG-- 190

  Fly   192 KVTNNMFCALGKNAR-DACQGDSGGPAIYAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLK 254
             :|:.|.||...:.: .:||||||||....|:..|:||||:|||: |.|.:||.:.  ::..|:|
  Fly   191 -LTDRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVG--ALRSWIK 252

  Fly   255  254
              Fly   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 71/227 (31%)
Tryp_SPc 27..246 CDD:238113 71/226 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 71/234 (30%)
Tryp_SPc 32..254 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.