DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG34436

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:196 Identity:43/196 - (21%)
Similarity:76/196 - (38%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CGGVIISPNCVLTAAHCL---EGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQR 113
            |.|.:|....|:|:|.|:   |....::..|:: .|:..:.......||:||:.    ..:..:.
  Fly    54 CSGALIHKYFVITSASCVFNQERAIVRLGQLSI-KQEHIVSYSSDDYHVQSAYI----HRFYEKS 113

  Fly   114 GLDSDLAVIRLSRPFDIAGNASL----VKIDYNDLPPH--SNLTVLGWGAINEQGHNWNQCLQEA 172
            ..:.|:|::.|..  |:...|.:    :.:|.:|:...  .......|| |:|:     ..|..|
  Fly   114 NFEHDIALLELQN--DVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWG-IDEK-----YILPAA 170

  Fly   173 NVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGR--------SVGIVSW 229
            ....|.|...:|...:......|:..||..|| :..|. ::|.|.....|        ..||.|:
  Fly   171 KTSKIKHISQVKCENAFKLYPQNSHICAGYKN-KSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSY 233

  Fly   230 G 230
            |
  Fly   234 G 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 43/196 (22%)
Tryp_SPc 27..246 CDD:238113 43/196 (22%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 43/196 (22%)
Tryp_SPc 40..251 CDD:214473 43/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.