DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG34437

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:244 Identity:58/244 - (23%)
Similarity:101/244 - (41%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCL 69
            |..|.|.||  ||:.|...:.........:.|:..::..:....| .|.|.:|:...|:|.|.|:
  Fly     9 LFTLVLAHQ--GSAYFLDFECVNHKPHQDVFKETPWMAFIASPTK-NCSGTLINKQYVITTASCV 70

  Fly    70 EGRYQQVRDLTVHAQQQCLG--DDMPPEHVRSAWYVGLSPN-------YCAQRGLDSDLAVIRLS 125
               :.| .:.||.     ||  |::|....|   ||..|..       |..|. .:.|:|::.|.
  Fly    71 ---FDQ-SESTVF-----LGRFDNIPQNRNR---YVKHSVQSVYTHKLYNKQT-FEHDIALLLLD 122

  Fly   126 RPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEAN-VKLISHRECIKSVGSG 189
            .|.....:...:.|...::...::|....|| ::|:     ...|..| ||::..::|..|.|..
  Fly   123 DPVTFKMSIQPICIWLGEITNLNHLESNRWG-LSEK-----MIFQRINTVKILKIKKCRDSFGIT 181

  Fly   190 WQKVTNNMFCALGKNARDACQGDSGGPAI----YAGR----SVGIVSWG 230
            .:|   :..||..:|. :.|. ::|...:    |:|:    .:||.|:|
  Fly   182 LKK---SQICAGFQNG-NICT-ETGSSLVKQIHYSGKLWNTLIGIQSYG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 50/223 (22%)
Tryp_SPc 27..246 CDD:238113 50/222 (23%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 49/212 (23%)
Tryp_SPc 39..242 CDD:304450 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.