DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and PRSS3

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:237 Identity:83/237 - (35%)
Similarity:124/237 - (52%) Gaps:21/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGD 90
            ||.||.|.......:.|:|..|..| |||.:||...|::||||.:.|. ||| |..|..:...|:
Human   109 KIVGGYTCEENSLPYQVSLNSGSHF-CGGSLISEQWVVSAAHCYKTRI-QVR-LGEHNIKVLEGN 170

  Fly    91 DMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVL-- 153
            :   :.:.:|..: ..|.| .:..||:|:.:|:||.|..|  ||.:..|.....||.:....|  
Human   171 E---QFINAAKII-RHPKY-NRDTLDNDIMLIKLSSPAVI--NARVSTISLPTTPPAAGTECLIS 228

  Fly   154 GWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALG--KNARDACQGDSGGP 216
            |||.....|.::...|:..:..:::..||..|...   |:||:||| :|  :..:|:||.|||||
Human   229 GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPG---KITNSMFC-VGFLEGGKDSCQRDSGGP 289

  Fly   217 AIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFI 257
            .:..|:..|:||||:||. ...|||||::.  :...|:||.|
Human   290 VVCNGQLQGVVSWGHGCAWKNRPGVYTKVY--NYVDWIKDTI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 79/224 (35%)
Tryp_SPc 27..246 CDD:238113 78/223 (35%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 79/231 (34%)
Tryp_SPc 110..328 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.