DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG34130

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:232 Identity:57/232 - (24%)
Similarity:95/232 - (40%) Gaps:39/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVH------AQQQCLGDDMPPEH-- 96
            :|:.:..|..|.||...:|....||:|:|:.....|:..|:|.      .|...|....||..  
  Fly    57 WLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDNQLDSHDPPNALI 121

  Fly    97 ----VRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNA-SLVKIDYNDLPPHSNLTVLGWG 156
                |...|:         ..|...|:|||.|:.  .:.||. :.|.:..|.|..:.:|:|:.:|
  Fly   122 RNIIVSKDWH---------WPGTFMDVAVIELTN--RLRGNRNNYVTLCTNPLSSYKSLSVVSYG 175

  Fly   157 AINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAG 221
            |    |...|...:|  :::::...|..:.|:...:.|  :.||........|...:|.|.....
  Fly   176 A----GPAENVRTEE--IEVLNRMICDSAYGNFLLRET--VACAKEFKRSADCMFSAGCPVTAGD 232

  Fly   222 RSVGIVSWGYGC-GSGYPGVYTRLSSPSITYWLKDFI 257
            :..|||:|...| .|..||::|.:      :.:|.||
  Fly   233 QLCGIVAWSPACKRSNLPGIFTDI------HQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 54/219 (25%)
Tryp_SPc 27..246 CDD:238113 54/219 (25%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 55/230 (24%)
Tryp_SPc 53..256 CDD:304450 54/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.