DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG7829

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:282 Identity:82/282 - (29%)
Similarity:127/282 - (45%) Gaps:55/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTA 65
            ||.|...|.||......||.:....:|.||....:.:..::|:::..|...|||.||:.:.:|||
  Fly     2 MYKLWWKLLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66

  Fly    66 AHCLEG--------------RYQQ------VRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYC 110
            .|||.|              ||::      |.||.||       ::..|                
  Fly    67 GHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVH-------ENFNP---------------- 108

  Fly   111 AQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVK 175
              :.:|.|:.:|||::...::.....:.|:...:...:..|:.|||..:..|.. :..|:.|.|.
  Fly   109 --KTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVP 170

  Fly   176 LISHRECIKSVGSGWQKVTNNMFCALG--KNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGY 237
            :::...|...:|   :.||:.|.|| |  |...||||.|||||.....:.|||||||.||. :..
  Fly   171 IVNQTACRNLLG---KTVTDRMLCA-GYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADK 231

  Fly   238 PGVYTRLSSPSITYWLKDFIER 259
            ||||:||.  ::..||...:.:
  Fly   232 PGVYSRLD--ALHPWLDQVLNK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/242 (30%)
Tryp_SPc 27..246 CDD:238113 72/241 (30%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 72/248 (29%)
Tryp_SPc 28..248 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.