DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG9631

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:214 Identity:52/214 - (24%)
Similarity:86/214 - (40%) Gaps:44/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGKTTLVKDHSFLVNLRRG---GKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGD 90
            ||.......:.:|..|..|   ..::|...:||...|:|||||:.|:  ....|.|:..:....:
  Fly   199 GGDLVTRGQYPWLAALYEGVGTATYKCVVSVISKRTVITAAHCIYGK--SASQLWVYLGRHDRNE 261

  Fly    91 DMPPEHVRSAWYVG--LSPN-YCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDY----------N 142
            :  ||:..|...|.  |:|: |......|:|:.::.|:.|        :|...|          .
  Fly   262 N--PENGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSP--------MVYTKYIRPLCLWGSNM 316

  Fly   143 DLPPHSNLT--VLGWGAINEQGHNWNQCLQE------ANVKLISHRECIKSVGSGWQKVTNNMFC 199
            .|||:...|  |.|||        :::..|:      .:|:|:...:|:|.:......:|....|
  Fly   317 GLPPNEGDTGAVAGWG--------YDRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVC 373

  Fly   200 ALGKNARDACQGDSGGPAI 218
            |....:...|.||||...|
  Fly   374 AGNSESHGPCFGDSGSALI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 52/214 (24%)
Tryp_SPc 27..246 CDD:238113 52/214 (24%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 52/214 (24%)
Tryp_SPc 198..433 CDD:214473 52/214 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.