DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG11668

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:110/282 - (39%) Gaps:100/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGKIFGGKTTLVKDHSFLVNL----------------RRGGKFRCGGVIISPNCVLTAAHCL--- 69
            |..:.||:.|...:|.::..|                :|...|.||..:|:|...:|||||.   
  Fly   145 QNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVG 209

  Fly    70 ---------------EGRYQ--QVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDS 117
                           .||.|  :::.::.|                        |::.|:. |.:
  Fly   210 GESPSVALIGGVELNSGRGQLIEIKRISQH------------------------PHFDAET-LTN 249

  Fly   118 DLAVIRLSR----PFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKL-- 176
            ||||::|:|    |.....|...:        |...||.||:|.....|.:.:..||   :.|  
  Fly   250 DLAVVKLARRSHMPVACLWNQESL--------PERPLTALGYGQTKFAGPHSSNLLQ---IMLYH 303

  Fly   177 ISHRECIKSVGSGWQKVTNNM----FCALGKNAR-DACQGDSGGPAI-------------YAGRS 223
            ::.::|.:.: ..:.|:.|.:    .||...:.. |.||||||||.:             |.   
  Fly   304 LNFQQCQRYL-HNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYV--- 364

  Fly   224 VGIVSWGYGCGSGYPGVYTRLS 245
            |||.|:|..|.||.||||.|::
  Fly   365 VGITSFGGACASGQPGVYVRIA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 69/280 (25%)
Tryp_SPc 27..246 CDD:238113 69/279 (25%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/278 (25%)
Tryp_SPc 149..392 CDD:214473 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.