DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG10041

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:225 Identity:59/225 - (26%)
Similarity:100/225 - (44%) Gaps:25/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGDDMPPEH--VRSAWYVGL 105
            ||:...|..|.|||:|...||:||||::  ....:.|.|......|........  |...|:   
  Fly    59 NLKGYYKHLCVGVILSNEFVLSAAHCIQ--TNPTKQLYVAGGADSLNSRKQTRFFVVERRWH--- 118

  Fly   106 SPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLT---VLGWGAINEQGHNWNQ 167
             |.:....|  :|:||:|:...|.: .:.....|::...|...:.|   ::|||.:   |....:
  Fly   119 -PQFRVLGG--NDIAVLRIYPKFPL-DDVRFRSINFAGKPQRDSGTQASLVGWGRV---GVGKIR 176

  Fly   168 CLQEANVKLISHRECIKSVGSGWQKVTNNMFCALG-KNARDACQGDSGGPAIYAGRS--VGIVSW 229
            .|||.....:.:.||.:|....:.|..:  .||:. |..|..|.||||.|.:...:.  .|::|:
  Fly   177 KLQEMPFLTMENDECQQSHRFVFLKPLD--ICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSY 239

  Fly   230 G-YGCGSGYPGVYTRLSSPSITYWLKDFIE 258
            | ..|....|..:||:::.|  .|:::.::
  Fly   240 GRKACTPLKPYAFTRINAYS--SWIQESMD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 57/211 (27%)
Tryp_SPc 27..246 CDD:238113 57/211 (27%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 59/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.