DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG12951

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:73/248 - (29%)
Similarity:116/248 - (46%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRR-GGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQ-QCL 88
            ::..|..:.|..:.|:|:||. .|...|||.|||.:.|:|||||..||......:...... ..:
  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAM 93

  Fly    89 GDDMPPEHVRSAWYVGLS-----PNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLP--- 145
            |.::          ||:.     .::...|...:|::::.:..||:..|    |.:...:||   
  Fly    94 GPNV----------VGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDG----VSVAPVELPALA 144

  Fly   146 ---PHSNLTV----LGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGK 203
               |.|:..|    :||| :|:...:....|||.::|:.|..|| .|..:|......::...:.:
  Fly   145 FAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEEC-TSRHNGQTDPKYHICGGVDE 207

  Fly   204 NARDACQGDSGGPAIYAGRSVGIVSWGY-GCG-SGYPGVYTRLSSPSITYWLK 254
            ..:..|.||||||.||.|:.||||||.. .|. :.|||||.::|  ....|:|
  Fly   208 GGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS--QYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 70/238 (29%)
Tryp_SPc 27..246 CDD:238113 70/237 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/245 (29%)
Tryp_SPc 30..260 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.