DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Try10

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:234 Identity:80/234 - (34%)
Similarity:120/234 - (51%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGD 90
            ||.||.|.......:.|:|..|..| |||.:|:...|::||||.:.|. ||| |..|......|:
  Rat    23 KIVGGYTCQENSVPYQVSLNSGYHF-CGGSLINEQWVVSAAHCYKSRI-QVR-LGEHNINVLEGN 84

  Fly    91 DMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGW 155
            :   :.|.:|..: ..||: .::.|::|:.:|:||.|..:....:.|.:..:..|..:...:.||
  Rat    85 E---QFVNAAKII-KHPNF-IRKTLNNDIMLIKLSSPVKLNSRVATVALPSSCAPAGTQCLISGW 144

  Fly   156 GAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCA-LGKNARDACQGDSGGPAIY 219
            |.....|.|....||..:..|:...:|..|...   |:|:||.|| ..:..:|:||||||||.:.
  Rat   145 GNTLSFGVNEPDLLQCLDAPLLPQADCEASYPG---KITDNMVCAGFLEGGKDSCQGDSGGPVVC 206

  Fly   220 AGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFI 257
            .|...|||||||||. ...|||||::.  :...|::|.|
  Rat   207 NGELQGIVSWGYGCALPDNPGVYTKVC--NYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 77/221 (35%)
Tryp_SPc 27..246 CDD:238113 76/220 (35%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 77/228 (34%)
Tryp_SPc 24..242 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.