DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG10587

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:265 Identity:80/265 - (30%)
Similarity:123/265 - (46%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGKIFGGK-TTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQ-----------QV 76
            |.::.||. ||..:...:|:.||....|.|||.::....|||||||..||.:           ::
  Fly    43 QTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKL 107

  Fly    77 RDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPF--DIAGNASLVKI 139
            .|..:..|.:        |.::||.:        .:..::.|:|::||.:|.  ...|...|.| 
  Fly   108 NDRGIQRQVK--------EVIKSAEF--------REDDMNMDVAILRLKKPMKGKSLGQLILCK- 155

  Fly   140 DYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKS-VGSGWQK----------- 192
              ..|.|.:.|.|.|||..........:.|:...|.::..::|..| :.:.|:.           
  Fly   156 --KQLMPGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVH 218

  Fly   193 VTNNMFCA--LGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLK 254
            :|::||||  |||  :|||..|||||.:|..:..||||:|.||.| .|.||||.:      .::|
  Fly   219 LTDSMFCAGVLGK--KDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDI------MYVK 275

  Fly   255 DFIER 259
            .|||:
  Fly   276 PFIEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 75/248 (30%)
Tryp_SPc 27..246 CDD:238113 75/247 (30%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 76/259 (29%)
Tryp_SPc 46..280 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.