DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Sems

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:130/292 - (44%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYILLIGLALL--HQLEGSSLFTLR-----------QGKIFGGK-TTLVKDHSFLVNLRRGGKFR 51
            :::.|:...|:  |.|:.:....|:           |.::.||: ||..|...:||.:|....|.
  Fly     5 LFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFI 69

  Fly    52 CGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRG-- 114
            |||.:|....|||||||.|.|.:                       :.||.|....:..:::|  
  Fly    70 CGGTLIHELIVLTAAHCFEDRAE-----------------------KEAWSVDGGISRLSEKGIR 111

  Fly   115 ----------------LDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGH 163
                            ::.|:||:.|:||. :..|...:.:....|.|...:.|.|||..|....
  Fly   112 RQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDE 175

  Fly   164 NWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCA--LGKNARDACQGDSGGPAIYAGRSVGI 226
            .....|:..:|.:|..|.|.::.... ..::::||||  |||  :|||..|||||.:|..:..||
  Fly   176 GPGHMLRTVSVPVIEKRICREAYRES-VSISDSMFCASVLGK--KDACTYDSGGPLVYEKQVCGI 237

  Fly   227 VSWGYGCGS-GYPGVYTRLSSPSITYWLKDFI 257
            ||:|.||.| .||||||.:      :::|.||
  Fly   238 VSFGIGCASRRYPGVYTDV------HYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 75/241 (31%)
Tryp_SPc 27..246 CDD:238113 75/240 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 76/252 (30%)
Tryp_SPc 44..265 CDD:238113 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.