DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG4998

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:116/231 - (50%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGDDMP--PEHVRSAWYVGLSPNYCAQ 112
            :.|||.:|....:::||||::.  |...||.|...:..:..|:.  |...|....|.:.|.|.|.
  Fly   964 YACGGTLIDAQHIISAAHCIKS--QNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAG 1026

  Fly   113 RGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLT-----VLGWG--AINEQGHNWNQCLQ 170
            . ||:||||::|.:|.|...|..:......|  .:|:.|     ..|||  |..|.| .:...|:
  Fly  1027 T-LDNDLAVLKLDQPVDFTKNPHISPACLPD--KYSDFTGARCWTTGWGKDAFGEHG-KYQNILK 1087

  Fly   171 EANVKLISHREC---IKSVGSGWQ-KVTNNMFCALGKNARDACQGDSGGPAIY----AGRSVGIV 227
            |.:|.::||::|   :::...|:. |:.....||.|:..:|||:||.|||.:.    |...||:|
  Fly  1088 EVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNGAMHVVGVV 1152

  Fly   228 SWGYGCGS-GYPGVYTRLSSPSITY--WLKDFIERH 260
            |||.|||. ..||||.::|:    |  |::...:.:
  Fly  1153 SWGIGCGQVNVPGVYVKVSA----YLPWIQQITQSY 1184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 71/213 (33%)
Tryp_SPc 27..246 CDD:238113 71/213 (33%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 74/225 (33%)
Tryp_SPc 942..1177 CDD:214473 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.