DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG16998

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:129/262 - (49%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTA 65
            |.||.:.|.|:...:.|:|..  |.:|.||....:....:|.::...|.:.|...:|:...::||
  Fly     1 MNILALILLLICGHKTSALSP--QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTA 63

  Fly    66 AHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDI 130
            .||:    |.....:|.|............:|.|   |.|.|:: ..|.|::|:|:::|.:.|.:
  Fly    64 GHCV----QYPDSYSVRAGSTFTDGGGQRRNVVS---VILHPDF-NLRTLENDIALLKLDKSFTL 120

  Fly   131 AGNASLVKI---DYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQK 192
            .||..:||:   ..|.||  ..|.|.|||..:.........|:...||:|:.|.|.:......:.
  Fly   121 GGNIQVVKLPLPSLNILP--RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRP 183

  Fly   193 VTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLKDF 256
            :|::|.||.|. .||.|.||||.|.::.|.|.||||:.:||.. .:|||||||:  :...|:.:.
  Fly   184 ITDDMVCAAGA-GRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLA--NYVTWIFNV 245

  Fly   257 IE 258
            :|
  Fly   246 LE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 71/223 (32%)
Tryp_SPc 27..246 CDD:238113 71/222 (32%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 71/230 (31%)
Tryp_SPc 25..242 CDD:238113 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.