DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG13430

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:87/266 - (32%)
Similarity:129/266 - (48%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHC-LEGRYQQVRDLTVHAQQQ 86
            :.|:|.||..|.:......|:|:.|.:..|||.|||||.:|||||| ||  |.:.:...:.|.. 
  Fly    28 QDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLE--YSKPQYYVIRAGS- 89

  Fly    87 CLGDDMPPEHVRSAWYVGLS----------PNYCAQRGLDSDLAVIRLS---------RPFDIAG 132
                        |.|..|.|          |.:.....:::|:|:::|.         ||..:|.
  Fly    90 ------------SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLAT 142

  Fly   133 NASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKS-VGSGWQKVTNN 196
            :..::.       |.:.|.|.|||:.:.......:.|:...|.|....:|.:: .|:|  .|||.
  Fly   143 SKDIIM-------PTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAG--TVTNT 198

  Fly   197 MFCALGKNA--RDACQGDSGGPAIYA--GR--SVGIVSWGYGCGSG-YPGVYTRLSSPSITY--W 252
            |||| |..|  ||:||||||||.:.:  ||  ..||||||:||.:. :||:||::|:    |  |
  Fly   199 MFCA-GTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSA----YDDW 258

  Fly   253 LKDFIE 258
            :...||
  Fly   259 IAQTIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 81/247 (33%)
Tryp_SPc 27..246 CDD:238113 81/246 (33%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/256 (32%)
Tryp_SPc 32..262 CDD:238113 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.