DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG32269

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:233 Identity:76/233 - (32%)
Similarity:121/233 - (51%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCL 88
            |.:|.||.:|.:....::|.||||... |.|.:|:...|||||||::|  ....|.||......|
  Fly   106 QSRIVGGTSTTISTTPYIVQLRRGSNL-CSGSLITEQWVLTAAHCVKG--YSASDFTVRGGTTTL 167

  Fly    89 -GDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPH--SNL 150
             |.|.....|.|   :.::|.:.::: ::.|.|:::|::  .:.| .::..|...:..|.  |.:
  Fly   168 DGSDGVTRSVSS---IHVAPKFTSKK-MNMDAALLKLNQ--SLTG-TNIGTISMGNYRPKAGSRV 225

  Fly   151 TVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGG 215
            .:.|||...|.....::.||.|.::::..::|.|.. .|...:|..|.||... .:|:|.|||||
  Fly   226 RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDY-RGQATITKYMLCARAA-GKDSCSGDSGG 288

  Fly   216 PAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYW 252
            |.......:||||:||||. :|||||||.:  .:|..|
  Fly   289 PVTRNNTLLGIVSFGYGCARAGYPGVYTAV--VAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 73/223 (33%)
Tryp_SPc 27..246 CDD:238113 73/222 (33%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 74/229 (32%)
Tryp_SPc 121..324 CDD:238113 70/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112457
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.