DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG32833

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:113/262 - (43%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEG---RYQQVR------------- 77
            ||....:....::.::....|.:|.|.|...:.::||..|::|   :..:||             
  Fly    40 GGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIEV 104

  Fly    78 ---DLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKI 139
               ::|||.:                 :.|        :.:..::|:::|..|.:.:.....:::
  Fly   105 AVCNITVHEK-----------------FTG--------QTVFHNVAILKLCEPLEASKTIQPIQL 144

  Fly   140 DYNDLPPH-SNLTVLGWGAINEQGHNWNQC-------LQEANVKLISHRECIKS-VGSGWQK--V 193
             .|.||.: :.:|..||.:.......|.:|       ||:|.|||:...:|... ..:.|.|  .
  Fly   145 -ANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNF 208

  Fly   194 TNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCGSGYPGVYTRLSSPSITYWLKDFIE 258
            |:::||. .|.|::||....|.|.::.|:.|||::.| || |.||.||..|    |.|  ||::.
  Fly   209 TDDLFCT-EKFAKEACSLAMGSPVVHNGKLVGIITKG-GC-SEYPEVYINL----IKY--KDWLH 264

  Fly   259 RH 260
            .|
  Fly   265 NH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 58/246 (24%)
Tryp_SPc 27..246 CDD:238113 58/246 (24%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/260 (24%)
Tryp_SPc 40..262 CDD:214473 61/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.