DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG8299

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:279 Identity:79/279 - (28%)
Similarity:119/279 - (42%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLIGLALLHQL------EGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFR---CGGVIISP 59
            |.:||.||..|      :.:|:.|    .|.||....:.|..:.|::|......   |||.|.:|
  Fly     3 LRLGLFLLAALGVVILTDSASIST----HIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAP 63

  Fly    60 NCVLTAAHCLEGRYQQVRDLTVHAQQQCLGD----------DMPPEHVRSAWYVGLSPNYCAQRG 114
            ..|:|||||::|||...  :.:.|.|..:.|          .:|........||           
  Fly    64 RVVITAAHCIKGRYASY--IRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYV----------- 115

  Fly   115 LDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISH 179
              :|:.:|....|.:.:.....:.:.....|..:...|.|||...|........|:...:::|..
  Fly   116 --NDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEK 178

  Fly   180 RECIKSVGSGWQKVTNNMFCALG--KNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVY 241
            ..|.....:....||:.|.|| |  :..:|.|.||||||....|..||:||||.||| .|:||||
  Fly   179 STCGAQYLTKDYTVTDEMLCA-GYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVY 242

  Fly   242 TRLSSPSITYWLKDFIERH 260
            |.::|.  ..|:::..|.:
  Fly   243 TSVNSH--IDWIEEQAEAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 68/235 (29%)
Tryp_SPc 27..246 CDD:238113 68/234 (29%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 69/242 (29%)
Tryp_SPc 28..255 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.