DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Ser8

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:77/265 - (29%)
Similarity:123/265 - (46%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAH 67
            ::.|||    :.:.|||    .|:|.||..:.::|..:.|:|:|.|...|||.|||.|.::||||
  Fly    19 VIPIGL----EPQTSSL----GGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAH 75

  Fly    68 CLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLD--------SDLAVIRL 124
            ||: ....|.:|.:.|..            ....|.|:.....|.:..:        :|:.|:||
  Fly    76 CLD-TPTTVSNLRIRAGS------------NKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRL 127

  Fly   125 SRPFDIAGNASLVKIDYNDLPPH-SNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGS 188
            ............:.: .:..|.| |..::.|||..:..|.: :..|...:.:::...:|..|...
  Fly   128 KTKLTFGSTIKAITM-ASATPAHGSAASISGWGKTSTDGPS-SATLLFVDTRIVGRSQCGSSTYG 190

  Fly   189 GWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYW 252
            ....:...|.||...| :||||||||||.:..|:.||:||||..|. :.|||||..::.      
  Fly   191 YGSFIKATMICAAATN-KDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAE------ 248

  Fly   253 LKDFI 257
            |:|::
  Fly   249 LRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 68/229 (30%)
Tryp_SPc 27..246 CDD:238113 68/228 (30%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 70/240 (29%)
Tryp_SPc 35..253 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.