DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG1773

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:289 Identity:68/289 - (23%)
Similarity:108/289 - (37%) Gaps:96/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRRGGKF---RCGGVIISPNCVLTAAHCLE--GRYQQVR----DLTV 81
            :|.||:.:.:....::..|...|..   ||||.::|...|||||||.:  .|.:::|    :|.:
  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125

  Fly    82 HAQQQCLGDD------MPPEHVR-SAWYVG-----LSPNYCAQRGLDSDLAVIRLSRPFDIAGNA 134
            .:...|:..:      :|.|... ..|.:.     ..|.|        |:|:|:|::        
  Fly   126 SSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY--------DIALIKLNK-------- 174

  Fly   135 SLVKIDYND------LPPHSNL-----------TVLGWGAINEQGHNWNQCLQEANVKLISHREC 182
               |:.:.|      ||....|           ..:|||  ..:...:.....|.::..      
  Fly   175 ---KVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWG--RTESRRFANSTMEVHINT------ 228

  Fly   183 IKSVGSGWQKVTN----NMFCALGKNARDACQGDSGGPAIY------AGRSV--GIVSWG-YGCG 234
                    :|.|:    :..||.|... |.|.||||||.|:      ..|:|  |:||.| ..||
  Fly   229 --------EKCTDGRDTSFLCANGDYV-DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG 284

  Fly   235 SGYPGVYTRLSSPSITYW-------LKDF 256
            :|....|  :..|:...|       |.||
  Fly   285 AGQKAYY--MDVPTYVPWILAKMAELSDF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 63/270 (23%)
Tryp_SPc 27..246 CDD:238113 63/269 (23%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 64/277 (23%)
Tryp_SPc 62..301 CDD:238113 64/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.