DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Phae2

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:73/256 - (28%)
Similarity:115/256 - (44%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIGLALLHQLEGSSL-FTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAA 66
            |||:.:.:   .:||.| ....:|::.|||........::|:::.||...|...||:.|.::|||
  Fly    10 ILLLAVCV---SQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71

  Fly    67 HCLEGRYQQVRDLTVHAQQQCLGDDMPPE------HVRSAWYVGLSPNYCAQRGLDSDLAVIRLS 125
            |||..|.|.:....|.......|.....:      :|.:..|.|.:..|        |:.:|...
  Fly    72 HCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPY--------DIGLIYTP 128

  Fly   126 RPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINE-QGHNWNQCLQEA-NVKLISHRECIKSVGS 188
            ..|......:.||:..:.:.|.....:.|||:.:: ...::.:.|||| |:.:||...|..::||
  Fly   129 TAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGS 193

  Fly   189 GWQKV-TNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWG-YGCGS-GYPGVYTRLSS 246
            ..|.| |.|:...........|..|||||.:.....:|||||| ..||. ..|.||.::||
  Fly   194 KGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 64/230 (28%)
Tryp_SPc 27..246 CDD:238113 64/229 (28%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 66/232 (28%)
Tryp_SPc 32..262 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.